PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc01696.1.g00030.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

NAC

Protein Properties

Length: 146aa MW: 16885.3 Da PI: 6.5207

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc01696.1.g00030.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	147.7	5.8e-46	20	146	1	126
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 lp Gf FhP+dee++++yLk+k ++++++ ++i+++di+++ePw+Lp+k+k +ekewyf++++d+ky++g r nrat++g Zmw_sc01696.1.g00030.1.sm.mk 20 LPLGFGFHPSDEEIITFYLKPKKLDSNFTA-DAIADADINNSEPWELPMKAKMGEKEWYFYCQKDHKYQKGVRINRATNDG 99 699**********************999.99***********99999************************ PP NAM 82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmhey 126 +Wka gkd+++ ++vg+kktLvfy gr+p gekt+W+mhey Zmw_sc01696.1.g00030.1.sm.mk 100 FWKAIGKDRDLSGIimMPAVVGMKKTLVFYIGRSPWGEKTEWIMHEY 146 *****98765557888************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.27E-49	17	146	IPR003441	NAC domain
PROSITE profile	PS51005	47.288	20	146	IPR003441	NAC domain
Pfam	PF02365	2.5E-23	21	146	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
MENHKYEGIR GTVDDAGLNL PLGFGFHPSD EEIITFYLKP KKLDSNFTAD AIADADINNS 60 EPWELPMKAK MGEKEWYFYC QKDHKYQKGV RINRATNDGF WKAIGKDRDL SGIIMMPAVV 120 GMKKTLVFYI GRSPWGEKTE WIMHEY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-38	8	146	5	140	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-38	8	146	5	140	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-38	8	146	5	140	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-38	8	146	5	140	NO APICAL MERISTEM PROTEIN
3swm_A	3e-38	8	146	8	143	NAC domain-containing protein 19
3swm_B	3e-38	8	146	8	143	NAC domain-containing protein 19
3swm_C	3e-38	8	146	8	143	NAC domain-containing protein 19
3swm_D	3e-38	8	146	8	143	NAC domain-containing protein 19
3swp_A	3e-38	8	146	8	143	NAC domain-containing protein 19
3swp_B	3e-38	8	146	8	143	NAC domain-containing protein 19
3swp_C	3e-38	8	146	8	143	NAC domain-containing protein 19
3swp_D	3e-38	8	146	8	143	NAC domain-containing protein 19
4dul_A	3e-38	8	146	5	140	NAC domain-containing protein 19
4dul_B	3e-38	8	146	5	140	NAC domain-containing protein 19
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:18305205, ECO:0000305\|PubMed:15723790}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024983086.1	6e-57	NAC domain-containing protein 92-like
Swissprot	Q9FLR3	2e-53	NAC79_ARATH; NAC domain-containing protein 79
TrEMBL	A0A118JZL6	1e-55	A0A118JZL6_CYNCS; No apical meristem (NAM) protein
TrEMBL	W5D096	1e-55	W5D096_WHEAT; Uncharacterized protein
STRING	Traes_3B_9A0FAE972.1	2e-56	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP35136	2	4

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vidal EA,Álvarez JM,Gutiérrez RA Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function. Plant Signal Behav, 2014. 9(3): p. e28501 [PMID:24642706] Lee MH,Jeon HS,Kim HG,Park OK An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164. New Phytol., 2017. 214(1): p. 343-360 [PMID:28032643]