PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc01855.1.g00140.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

bZIP

Protein Properties

Length: 67aa MW: 7999.21 Da PI: 11.5435

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc01855.1.g00140.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.2	5e-15	21	63	5	47
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r++r++kNRe+A rsR+RK a++ eLe+kv Le+eN++L+ Zmw_sc01855.1.g00140.1.sm.mk 21 RRQKRMIKNRESAARSRARKMAYTSELETKVSRLEEENERLRR 63 79***************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.0E-5	15	67	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.1E-15	15	64	No hit	No description
PRINTS	PR00041	5.8E-5	16	32	IPR001630	cAMP response element binding (CREB) protein
PROSITE profile	PS50217	11.542	19	67	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.5E-11	21	65	No hit	No description
Pfam	PF00170	1.2E-12	21	64	IPR004827	Basic-leucine zipper domain
PROSITE pattern	PS00036	0	24	39	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	5.8E-5	34	54	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	5.8E-5	54	67	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MTAPGRKRGT TGYVEDKLME RRQKRMIKNR ESAARSRARK MAYTSELETK VSRLEEENER 60 LRRQKKA

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004961684.1	8e-27	ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
Refseq	XP_025818578.1	3e-27	ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
Refseq	XP_025818579.1	3e-27	ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2
Swissprot	Q9LES3	1e-24	AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBL	A0A2S3HQM9	7e-26	A0A2S3HQM9_9POAL; Uncharacterized protein
TrEMBL	A0A2T7DFC8	7e-26	A0A2T7DFC8_9POAL; Uncharacterized protein
STRING	Traes_3AL_58F294736.2	7e-27	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2707	38	83

Publications ? help Back to Top
Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655]