PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc01949.1.g00100.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

M-type_MADS

Protein Properties

Length: 89aa MW: 10027.6 Da PI: 10.5341

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc01949.1.g00100.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	93.4	1.1e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA ELS+LCdaev +i+fsstg+lye++s Zmw_sc01949.1.g00100.1.am.mk 10 RIDNSTSRQVTFSKRRNGLLKKARELSILCDAEVGLIVFSSTGRLYEFCS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	8.1E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.057	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.34E-45	2	77	No hit	No description
SuperFamily	SSF55455	2.09E-33	2	77	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-30	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.1E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-30	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KARELSILCD AEVGLIVFSS TGRLYEFCST 60 DMKAVIERYA KAKEEQLGAN NATSELMVR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	7e-24	1	82	1	82	MEF2C
5f28_B	7e-24	1	82	1	82	MEF2C
5f28_C	7e-24	1	82	1	82	MEF2C
5f28_D	7e-24	1	82	1	82	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021315544.1	6e-52	MADS-box transcription factor 57-like isoform X3
Refseq	XP_021315545.1	5e-52	MADS-box transcription factor 57-like isoform X4
Swissprot	Q6Z6W2	4e-46	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A194YSL3	1e-50	A0A194YSL3_SORBI; Uncharacterized protein
TrEMBL	A0A1Z5RNX8	1e-50	A0A1Z5RNX8_SORBI; Uncharacterized protein
TrEMBL	A0A1Z5RNZ6	1e-50	A0A1Z5RNZ6_SORBI; Uncharacterized protein
STRING	Pavir.Ab02921.1.p	2e-50	(Panicum virgatum)
STRING	Sb04g028960.2	3e-50	(Sorghum bicolor)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]