PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02329.1.g00130.1
Organism
Zoysia matrella
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 103aa    MW: 11474 Da    PI: 8.4914
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02329.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-18855148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+ Ed ll ++v+q+G g+W+++a+  g++R++k+c++rw +yl
  Zmw_sc02329.1.g00130.1.am.mk  8 KGPWTAPEDRLLTEYVQQHGEGCWSSVAKLTGLRRSGKSCRLRWVNYL 55
                                  79********************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.465159IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-23558IPR009057Homeodomain-like
SMARTSM007173.3E-15757IPR001005SANT/Myb domain
PfamPF002493.8E-17855IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-23983IPR009057Homeodomain-like
CDDcd001671.08E-111055No hitNo description
PROSITE profilePS500905.1115687IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.8E-85987IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MLQGGWRKGP WTAPEDRLLT EYVQQHGEGC WSSVAKLTGL RRSGKSCRLR WVNYLRPDLK  60
RGKITPDEET VILQLHAMLG NSLWRLVDGD NCGAGDGSSG GDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-168812799MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:22101548, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}.
UniProtTranscription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465878.14e-48transcription factor MYB2
RefseqXP_015630196.13e-48transcription factor WER
SwissprotO808832e-31MB101_ARATH; Transcription factor MYB101
SwissprotQ9SSA12e-32MYB57_ARATH; Transcription factor MYB57
TrEMBLA0A0E0NPI06e-47A0A0E0NPI0_ORYRU; Uncharacterized protein
TrEMBLA0A453J5H36e-47A0A453J5H3_AEGTS; Uncharacterized protein
TrEMBLI1P7G37e-47I1P7G3_ORYGL; Uncharacterized protein
TrEMBLQ10RX96e-47Q10RX9_ORYSJ; Myb-like DNA-binding domain containing protein
STRINGORUFI03G03040.11e-47(Oryza rufipogon)
STRINGOS03T0142600-001e-47(Oryza sativa)
STRINGORGLA03G0030900.11e-47(Oryza glaberrima)
STRINGSb01g047450.12e-47(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Publications ? help Back to Top
  1. Zheng Z, et al.
    Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy.
    Plant Physiol., 2017. 174(3): p. 1764-1778
    [PMID:28515145]
  2. Xue T,Liu Z,Dai X,Xiang F
    Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101.
    Plant Sci., 2017. 262: p. 182-189
    [PMID:28716415]