![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc02599.1.g00090.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 104aa MW: 11549 Da PI: 9.2307 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 38.7 | 2.3e-12 | 66 | 102 | 3 | 40 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
WT+eEde l +av + g++Wk+Ia+ ++ Rt+ ++
Zmw_sc02599.1.g00090.1.sm.mk 66 GWTPEEDETLRNAVDAFKGRQWKKIAEFVP-DRTEIEI 102
6*****************************.***9877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.998 | 50 | 104 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 7.9E-10 | 60 | 103 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.9E-11 | 63 | 102 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 2.0E-10 | 66 | 103 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 6.84E-9 | 67 | 104 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MPAVKVEERD GTEEKWRNLE VLLPSPSAGT SRGGARMSPV VSSPSDSVSR PSIKRTSGPV 60 RRAKSGWTPE EDETLRNAVD AFKGRQWKKI AEFVPDRTEI EIID |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269|PubMed:17293435, ECO:0000269|PubMed:19279197}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269|PubMed:17293435}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003568309.1 | 2e-31 | transcription factor MYB3R-2 isoform X2 | ||||
| Refseq | XP_025809063.1 | 7e-33 | transcription factor MYB3R-2-like isoform X2 | ||||
| Swissprot | Q0JHU7 | 3e-23 | MB3R2_ORYSJ; Transcription factor MYB3R-2 | ||||
| TrEMBL | A0A3L6R5F0 | 1e-30 | A0A3L6R5F0_PANMI; Myb-related protein A-like | ||||
| STRING | BRADI2G23315.1 | 2e-28 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3099 | 38 | 80 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




