![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc02673.1.g00030.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 87aa MW: 9563.55 Da PI: 6.0586 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 45.7 | 1.3e-14 | 10 | 46 | 23 | 59 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+YYrC+ gC++kk+ve++ ed+++v++tY g Hnh
Zmw_sc02673.1.g00030.1.sm.mk 10 NYYRCSADGCSMKKRVEQDCEDTRYVITTYDGVHNHA 46
6***********************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 1.2E-7 | 4 | 47 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 15.778 | 10 | 48 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 2.1E-13 | 10 | 48 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.8E-10 | 10 | 45 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.58E-12 | 10 | 48 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MEILDDGFWN YYRCSADGCS MKKRVEQDCE DTRYVITTYD GVHNHASPAA ATIMQYGGGT 60 RAHGFYSLPH NGSPLAATSY SSGSLLF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001309782.1 | 3e-31 | uncharacterized protein LOC107546771 | ||||
| Refseq | XP_020394763.1 | 3e-31 | uncharacterized protein LOC107546771 isoform X2 | ||||
| Swissprot | Q93WU9 | 2e-14 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
| TrEMBL | C4J6I0 | 7e-30 | C4J6I0_MAIZE; Putative WRKY transcription factor 50 | ||||
| STRING | GRMZM2G163054_P04 | 1e-30 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP44308 | 3 | 3 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




