![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc02690.1.g00010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 61aa MW: 6877.2 Da PI: 11.5453 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 81.6 | 5.1e-26 | 10 | 56 | 2 | 48 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
rien rqvtf+kRr+g+lKKA ELSvLCda++ +iifs +gkly+
Zmw_sc02690.1.g00010.1.sm.mk 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDARIGIIIFSAHGKLYD 56
8********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.9E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.62E-25 | 1 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.492 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.40E-34 | 2 | 61 | No hit | No description |
| PRINTS | PR00404 | 3.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.5E-24 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD ARIGIIIFSA HGKLYDLATT 60 G |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_B | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_C | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_D | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023157970.1 | 3e-36 | MADS-box transcription factor 26 isoform X5 | ||||
| Swissprot | A2YQK9 | 4e-35 | MAD26_ORYSI; MADS-box transcription factor 26 | ||||
| Swissprot | Q0J8G8 | 4e-35 | MAD26_ORYSJ; MADS-box transcription factor 26 | ||||
| TrEMBL | A0A287WYE6 | 2e-35 | A0A287WYE6_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A287WYF1 | 4e-35 | A0A287WYF1_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A287WYP6 | 4e-35 | A0A287WYP6_HORVV; Uncharacterized protein | ||||
| STRING | OPUNC08G01030.1 | 3e-35 | (Oryza punctata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




