PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03252.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 76aa    MW: 8351.68 Da    PI: 11.4926
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03252.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS63.54.4e-201375312374
                          GRAS 312 lekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                      Wr+ l +aGF pv+ s++a++qa++ll+kv+++g+rve++ gsl+l W++ +Lvsv+ Wr
  Zmw_sc03252.1.g00010.1.am.mk  13 TPPWRALLASAGFVPVQASSFAEAQADSLLKKVPVRGFRVEKRAGSLLLHWQRGELVSVTTWR 75 
                                   678***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.235155IPR005202Transcription factor GRAS
PfamPF035141.5E-171375IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
VSKYRGAIAG DRTPPWRALL ASAGFVPVQA SSFAEAQADS LLKKVPVRGF RVEKRAGSLL  60
LHWQRGELVS VTTWRC
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468689.23e-39scarecrow-like protein 6
RefseqXP_021304770.16e-42scarecrow-like protein 6
SwissprotQ7XJM83e-21SCL27_ARATH; Scarecrow-like protein 27
TrEMBLA0A0A9H9V79e-38A0A0A9H9V7_ARUDO; Uncharacterized protein
TrEMBLA0A0A9HIY93e-39A0A0A9HIY9_ARUDO; Uncharacterized protein
STRINGGRMZM2G060265_P016e-36(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5463022
Publications ? help Back to Top
  1. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]
  2. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  3. Takanashi H, et al.
    miRNAs control HAM1 functions at the single-cell-layer level and are essential for normal embryogenesis in Arabidopsis.
    Plant Mol. Biol., 2018. 96(6): p. 627-640
    [PMID:29574557]