PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc03527.1.g00080.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

MIKC_MADS

Protein Properties

Length: 185aa MW: 21134.2 Da PI: 9.451

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc03527.1.g00080.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100	9.2e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyeys+ Zmw_sc03527.1.g00080.1.sm.mk 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYST 59 79***********************************************96 PP
2	K-box	26.5	2.6e-10	63	113	37	99
K-box 37 hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 hl+Ge+Le+L+lkeLqqLeqq ++l+le+i+elq+kek+lqeenk L+k+l Zmw_sc03527.1.g00080.1.sm.mk 63 HLMGEELETLKLKELQQLEQQ------------SQLMLESISELQRKEKSLQEENKVLQKELV 113 9****************97............89**********************9985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	6.6E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.165	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.99E-39	2	61	No hit	No description
SuperFamily	SSF55455	1.96E-30	2	73	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.3E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.1E-32	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	7.349	40	129	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEYSTD 60 SWHLMGEELE TLKLKELQQL EQQSQLMLES ISELQRKEKS LQEENKVLQK ELVEKQKAQK 120 QQVQWEHGQQ PQTSSSSSTF KTREAPPTVN ISTYPVAAGV RVDGAPERPE VCFGLPPWMM 180 SHLNG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-20	1	60	1	61	MEF2C
5f28_B	1e-20	1	60	1	61	MEF2C
5f28_C	1e-20	1	60	1	61	MEF2C
5f28_D	1e-20	1	60	1	61	MEF2C
6byy_A	1e-20	1	60	1	61	MEF2 CHIMERA
6byy_B	1e-20	1	60	1	61	MEF2 CHIMERA
6byy_C	1e-20	1	60	1	61	MEF2 CHIMERA
6byy_D	1e-20	1	60	1	61	MEF2 CHIMERA
6bz1_A	1e-20	1	60	1	61	MEF2 CHIMERA
6bz1_B	1e-20	1	60	1	61	MEF2 CHIMERA
6bz1_C	1e-20	1	60	1	61	MEF2 CHIMERA
6bz1_D	1e-20	1	60	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|Ref.9}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004981740.1	5e-77	MADS-box transcription factor 14 isoform X1
Swissprot	Q10CQ1	3e-72	MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBL	A0A0A9QQM8	1e-85	A0A0A9QQM8_ARUDO; Uncharacterized protein
STRING	BRADI1G08340.1	2e-73	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1151	37	113

Publications ? help Back to Top
Jia H, et al. Characterization and transcriptional profiles of two rice MADS-box genes. Plant Sci., 2000. 155(2): p. 115-122 [PMID:10814814] Jang S,An K,Lee S,An G Characterization of tobacco MADS-box genes involved in floral initiation. Plant Cell Physiol., 2002. 43(2): p. 230-8 [PMID:11867703] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465] Li D, et al. Functional characterization of rice OsDof12. Planta, 2009. 229(6): p. 1159-69 [PMID:19198875] Tanaka N, et al. The COP1 ortholog PPS regulates the juvenile-adult and vegetative-reproductive phase changes in rice. Plant Cell, 2011. 23(6): p. 2143-54 [PMID:21705640] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Su L,Shan JX,Gao JP,Lin HX OsHAL3, a Blue Light-Responsive Protein, Interacts with the Floral Regulator Hd1 to Activate Flowering in Rice. Mol Plant, 2016. 9(2): p. 233-244 [PMID:26537047] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]