PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc04234.1.g00020.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

WRKY

Protein Properties

Length: 192aa MW: 21282.5 Da PI: 9.7924

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc04234.1.g00020.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	105.8	2.2e-33	101	159	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+ Zmw_sc04234.1.g00020.1.sm.mkhc 101 LDDGYRWRKYGQKAVKNNNFPRSYYRCTHQGCNVKKQVQRLSKDEGVVVTTYEGTHTHP 159 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.1E-34	86	159	IPR003657	WRKY domain
SuperFamily	SSF118290	4.32E-30	93	160	IPR003657	WRKY domain
PROSITE profile	PS50811	30.079	96	161	IPR003657	WRKY domain
SMART	SM00774	1.0E-39	101	160	IPR003657	WRKY domain
Pfam	PF03106	2.1E-27	102	159	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000122	Biological Process	negative regulation of transcription from RNA polymerase II promoter
GO:0010055	Biological Process	atrichoblast differentiation
GO:0032107	Biological Process	regulation of response to nutrient levels
GO:0043620	Biological Process	regulation of DNA-templated transcription in response to stress
GO:0048527	Biological Process	lateral root development
GO:0005634	Cellular Component	nucleus
GO:0001046	Molecular Function	core promoter sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 192 aa Download sequence Send to blast
MESNYHPMLF ATQPSSSTSN SYPFMAGTSG HDVRDRRGSF LGEPSNSKDG VSPPELGEAS 60 AGGAGDADRS RGGVNLGKKK GEKKERRPRY AFQTRSQVDI LDDGYRWRKY GQKAVKNNNF 120 PRSYYRCTHQ GCNVKKQVQR LSKDEGVVVT TYEGTHTHPI EKSNDNFEHI LTQMQIYSGI 180 GGSGFSSSSM FP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-27	92	160	8	76	Probable WRKY transcription factor 4
2lex_A	3e-27	92	160	8	76	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00506	DAP	Transfer from AT5G13080	Download

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004979296.1	2e-87	probable WRKY transcription factor 75
Refseq	XP_025826644.1	6e-87	probable WRKY transcription factor 12 isoform X1
Refseq	XP_025826645.1	3e-87	probable WRKY transcription factor 75 isoform X2
Swissprot	Q9FYA2	2e-55	WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBL	A0A2S3IEZ6	6e-86	A0A2S3IEZ6_9POAL; Uncharacterized protein
TrEMBL	A0A3B6APP7	5e-86	A0A3B6APP7_WHEAT; Uncharacterized protein
TrEMBL	K3ZJV4	5e-86	K3ZJV4_SETIT; Uncharacterized protein
STRING	Si026859m	8e-87	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1100	38	133

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xu L, et al. Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Zhang S, et al. The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] Guo P, et al. A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]