PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc04412.1.g00070.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

M-type_MADS

Protein Properties

Length: 90aa MW: 10132 Da PI: 10.3516

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc04412.1.g00070.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.7	2.6e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyey++ Zmw_sc04412.1.g00070.1.am.mk 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYAT 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.207	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	5.2E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.44E-38	2	61	No hit	No description
SuperFamily	SSF55455	1.01E-30	2	65	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.4E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.4E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.4E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEYATD 60 SWYALNSASI SPLFQPPRLL ACCCSISVRI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	5e-21	1	59	1	59	MEF2C
5f28_B	5e-21	1	59	1	59	MEF2C
5f28_C	5e-21	1	59	1	59	MEF2C
5f28_D	5e-21	1	59	1	59	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|Ref.9}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027773500.1	2e-36	agamous-like MADS-box protein AGL8 homolog isoform X3
Swissprot	Q10CQ1	2e-35	MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBL	A0A3L6EH16	1e-37	A0A3L6EH16_MAIZE; MADS-box transcription factor 14
STRING	XP_004172815.1	7e-38	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Publications ? help Back to Top
Jia H, et al. Characterization and transcriptional profiles of two rice MADS-box genes. Plant Sci., 2000. 155(2): p. 115-122 [PMID:10814814] Jang S,An K,Lee S,An G Characterization of tobacco MADS-box genes involved in floral initiation. Plant Cell Physiol., 2002. 43(2): p. 230-8 [PMID:11867703] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465] Li D, et al. Functional characterization of rice OsDof12. Planta, 2009. 229(6): p. 1159-69 [PMID:19198875] Tanaka N, et al. The COP1 ortholog PPS regulates the juvenile-adult and vegetative-reproductive phase changes in rice. Plant Cell, 2011. 23(6): p. 2143-54 [PMID:21705640] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Su L,Shan JX,Gao JP,Lin HX OsHAL3, a Blue Light-Responsive Protein, Interacts with the Floral Regulator Hd1 to Activate Flowering in Rice. Mol Plant, 2016. 9(2): p. 233-244 [PMID:26537047] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]