![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc04777.1.g00030.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 10146.7 Da PI: 9.364 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.6 | 5.1e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEde+l d + ++G g+W++ +++ g++R +k+c++rw +yl
Zmw_sc04777.1.g00030.1.sm.mkhc 15 KGLWSPEEDEKLRDFILRHGHGCWSALPAKAGLNRNGKSCRLRWINYL 62
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 23.003 | 10 | 66 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.9E-23 | 10 | 65 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.6E-12 | 14 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.5E-15 | 15 | 62 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.04E-21 | 17 | 89 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.65E-10 | 18 | 62 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.0E-8 | 66 | 89 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MGCKACEKPK PNYRKGLWSP EEDEKLRDFI LRHGHGCWSA LPAKAGLNRN GKSCRLRWIN 60 YLRPGLKHGE FSPEEEETVM SLHAALGNK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015689021.1 | 1e-56 | PREDICTED: myb-related protein 308 | ||||
| Swissprot | Q9M0K4 | 5e-37 | LAF1_ARATH; Transcription factor LAF1 | ||||
| TrEMBL | A0A287UCU7 | 8e-56 | A0A287UCU7_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A453P5W5 | 5e-56 | A0A453P5W5_AEGTS; Uncharacterized protein | ||||
| TrEMBL | I1P2I3 | 5e-56 | I1P2I3_ORYGL; Uncharacterized protein | ||||
| TrEMBL | J3LF78 | 3e-55 | J3LF78_ORYBR; Uncharacterized protein | ||||
| STRING | OB02G32950.1 | 4e-56 | (Oryza brachyantha) | ||||
| STRING | ORGLA02G0218900.1 | 8e-57 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1707 | 37 | 109 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




