![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc05698.1.g00010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 55aa MW: 6302.95 Da PI: 7.8876 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 54 | 3.2e-17 | 1 | 37 | 23 | 59 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
sY+rCt+++C+vkk+ver ++d ++v++tYeg+H+h+
Zmw_sc05698.1.g00010.1.am.mk 1 SYFRCTHSNCRVKKRVERLSTDCRMVITTYEGRHTHS 37
8***********************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 7.4E-8 | 1 | 38 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 7.85E-13 | 1 | 37 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 3.7E-14 | 1 | 37 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 15.365 | 1 | 36 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.4E-11 | 1 | 36 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 55 aa Download sequence Send to blast |
SYFRCTHSNC RVKKRVERLS TDCRMVITTY EGRHTHSPCS DDAASGDHTD CFSSF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004953301.1 | 1e-32 | probable WRKY transcription factor 12 | ||||
| Swissprot | Q93WY4 | 7e-23 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
| TrEMBL | A0A0A9FHL0 | 1e-31 | A0A0A9FHL0_ARUDO; Uncharacterized protein | ||||
| STRING | Si018283m | 6e-32 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1138 | 38 | 130 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




