PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05698.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 55aa    MW: 6302.95 Da    PI: 7.8876
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05698.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY543.2e-171372359
                                  EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                                  sY+rCt+++C+vkk+ver ++d ++v++tYeg+H+h+
  Zmw_sc05698.1.g00010.1.am.mk  1 SYFRCTHSNCRVKKRVERLSTDCRMVITTYEGRHTHS 37
                                  8***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007747.4E-8138IPR003657WRKY domain
SuperFamilySSF1182907.85E-13137IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-14137IPR003657WRKY domain
PROSITE profilePS5081115.365136IPR003657WRKY domain
PfamPF031061.4E-11136IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
SYFRCTHSNC RVKKRVERLS TDCRMVITTY EGRHTHSPCS DDAASGDHTD CFSSF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953301.11e-32probable WRKY transcription factor 12
SwissprotQ93WY47e-23WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0A9FHL01e-31A0A0A9FHL0_ARUDO; Uncharacterized protein
STRINGSi018283m6e-32(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Yang L, et al.
    PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa.
    Sci Rep, 2016. 6: p. 18643
    [PMID:26819184]
  3. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  4. Han Y, et al.
    WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 149-159
    [PMID:30617455]