![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc05820.1.g00010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 88aa MW: 9905.2 Da PI: 9.5863 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 114.3 | 5.1e-36 | 39 | 88 | 5 | 54 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGgg 54
+cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg
Zmw_sc05820.1.g00010.1.am.mk 39 GEPCPRCESRETKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGG 88
678*********************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 2.0E-23 | 39 | 88 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 9.8E-31 | 40 | 88 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 27.754 | 40 | 88 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 42 | 78 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MQEPTRRPAP PFAGVDLRRP KGYPEPATVK VEEAPATAGE PCPRCESRET KFCYYNNYNT 60 SQPRHFCKSC RRYWTKGGSL RNVPVGGG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001132540.2 | 1e-44 | uncharacterized protein LOC100194004 | ||||
| Swissprot | P38564 | 4e-36 | MNB1A_MAIZE; Dof zinc finger protein MNB1A | ||||
| TrEMBL | A0A1E5V289 | 4e-46 | A0A1E5V289_9POAL; Dof zinc finger protein MNB1A | ||||
| STRING | OMERI09G10430.1 | 3e-45 | (Oryza meridionalis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP140 | 37 | 367 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




