![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc10776.1.g00010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 62aa MW: 6382.39 Da PI: 9.0464 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 49.3 | 1.4e-15 | 28 | 62 | 1 | 35 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhk 35
+CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk
Zmw_sc10776.1.g00010.1.sm.mk 28 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHK 62
7*********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 14.66 | 27 | 62 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.0E-14 | 28 | 62 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MASPSSTSNS AMSPVAAPGT TTPGAGAPCA ACKFLRRKCL PGCVFAPYFP PEEPQKFANV 60 HK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-25 | 21 | 62 | 4 | 45 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-25 | 21 | 62 | 4 | 45 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025818403.1 | 4e-34 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_025818404.1 | 4e-34 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Swissprot | Q9FML4 | 5e-19 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A2S3HY84 | 9e-33 | A0A2S3HY84_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7DRP8 | 9e-33 | A0A2T7DRP8_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A3L6SKA6 | 9e-33 | A0A3L6SKA6_PANMI; LOB domain-containing protein 4-like | ||||
| STRING | Pavir.J38993.1.p | 5e-33 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP8813 | 35 | 45 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




