![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma114g00480.1 | ||||||||
| Common Name | ZOSMA_114G00480 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 69aa MW: 7625 Da PI: 11.3086 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.6 | 1.2e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien++ rqvtfskRr g+lKKA EL vLCd+++ +iifs++g+++e+s+
Zosma114g00480.1 9 KKIENSTSRQVTFSKRRGGLLKKARELGVLCDVQIGIIIFSNSGRMFEFSN 59
78***********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 4.2E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.272 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.58E-28 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.62E-35 | 2 | 63 | No hit | No description |
| PRINTS | PR00404 | 3.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
MGRGKIEIKK IENSTSRQVT FSKRRGGLLK KARELGVLCD VQIGIIIFSN SGRMFEFSNP 60 DSRLALLL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 5e-19 | 1 | 67 | 1 | 67 | MEF2 CHIMERA |
| 6bz1_B | 5e-19 | 1 | 67 | 1 | 67 | MEF2 CHIMERA |
| 6bz1_C | 5e-19 | 1 | 67 | 1 | 67 | MEF2 CHIMERA |
| 6bz1_D | 5e-19 | 1 | 67 | 1 | 67 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010233633.1 | 8e-29 | MADS-box transcription factor 29-like isoform X2 | ||||
| Swissprot | Q84NC2 | 3e-28 | MAD31_ORYSJ; MADS-box transcription factor 31 | ||||
| Swissprot | Q8VWM8 | 1e-27 | M17_MAIZE; MADS-box protein ZMM17 | ||||
| Swissprot | Q9XGJ4 | 9e-28 | GGM13_GNEGN; MADS-box protein GGM13 | ||||
| TrEMBL | A0A0K9Q2C0 | 2e-40 | A0A0K9Q2C0_ZOSMR; MADS-box transcription factor 1 | ||||
| STRING | Traes_6AS_57E50EE92.3 | 3e-29 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13790.1 | 1e-28 | AGAMOUS-like 15 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma114g00480.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




