![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma118g00260.1 | ||||||||
| Common Name | ZOSMA_118G00260 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 72aa MW: 7733.28 Da PI: 10.6321 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 106.4 | 1.5e-33 | 8 | 71 | 7 | 70 |
S1FA 7 eakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+a+Gln G ivll+v +++++f+ gn +ly yaqk+lPP+kkkP+skkk+k+e+lkqG+++PGe
Zosma118g00260.1 8 DAQGLNSGTIVLLIVLTMVVLFFGGNVALYLYAQKTLPPKKKKPISKKKIKKERLKQGISAPGE 71
789************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 1.1E-31 | 8 | 71 | IPR006779 | DNA binding protein S1FA |
| ProDom | PD019013 | 3.0E-4 | 10 | 71 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MAEEFSGDAQ GLNSGTIVLL IVLTMVVLFF GGNVALYLYA QKTLPPKKKK PISKKKIKKE 60 RLKQGISAPG E* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 9e-22 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 9e-22 | DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 4e-14 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | A0A0K9Q1V7 | 2e-42 | A0A0K9Q1V7_ZOSMR; DNA-binding protein S1FA1 | ||||
| STRING | XP_010104121.1 | 3e-21 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5154 | 35 | 63 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma118g00260.1 |




