![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma230g00330.1 | ||||||||
| Common Name | ZOSMA_230G00330 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 77aa MW: 8353.05 Da PI: 10.3974 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 107.7 | 5.8e-34 | 11 | 76 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
e++GlnPG +vllvv g +l+f+ n ly+yaqk+lPP+kkkPvskkklk+eklkqG+++PGe
Zosma230g00330.1 11 DKESQGLNPGTVVLLVVMGAMLLFIGVNIGLYMYAQKTLPPKKKKPVSKKKLKKEKLKQGISAPGE 76
579**************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 1.2E-32 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MADEFEGNMF DKESQGLNPG TVVLLVVMGA MLLFIGVNIG LYMYAQKTLP PKKKKPVSKK 60 KLKKEKLKQG ISAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 9e-22 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 9e-22 | DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 1e-13 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | A0A0K9PKG0 | 6e-46 | A0A0K9PKG0_ZOSMR; DNA-binding protein S1FA1 | ||||
| STRING | XP_010104121.1 | 9e-22 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5154 | 35 | 63 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma230g00330.1 |




