PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zosma34g00830.1

Common Name

ZOSMA_34G00830

Organism

Zostera marina

Taxonomic ID

29655

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera

Family

MYB

Protein Properties

Length: 206aa MW: 23557.6 Da PI: 10.9484

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zosma34g00830.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.7	2.2e-17	14	59	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg WT+ Ed +l + v+++G+++W++Ia+ ++ gR++k+c++rw++ Zosma34g00830.1 14 RGHWTAGEDGKLRRIVEKYGPRNWNSIAENLP-GRSGKSCRLRWFNQ 59 899***************************.*********996 PP
2	Myb_DNA-binding	45.2	2.2e-14	66	108	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r +T++E+++l+ a + +G++ W++Iar ++ gRt++ +k+ w+ Zosma34g00830.1 66 RRQFTEDEEKKLITAQRVYGNK-WSLIARIFP-GRTDNAIKNQWH 108 5689****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.384	9	64	IPR017930	Myb domain
SMART	SM00717	3.4E-14	13	62	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.85E-29	14	107	IPR009057	Homeodomain-like
Pfam	PF00249	3.5E-17	14	59	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.1E-26	15	67	IPR009057	Homeodomain-like
CDD	cd00167	8.61E-13	17	58	No hit	No description
PROSITE profile	PS51294	16.622	65	115	IPR017930	Myb domain
SMART	SM00717	4.0E-12	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	2.7E-12	66	108	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.4E-19	68	114	IPR009057	Homeodomain-like
CDD	cd00167	4.82E-10	69	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 206 aa Download sequence Send to blast
MRISSVQTSG ACERGHWTAG EDGKLRRIVE KYGPRNWNSI AENLPGRSGK SCRLRWFNQL 60 DPRINRRQFT EDEEKKLITA QRVYGNKWSL IARIFPGRTD NAIKNQWHVI TARKRKEQKT 120 LALRRRHQYL CNNKKAFGFD TGRLFGQLSG SSSSSSFTST YIRLSNTSGE SFQVINLTEE 180 DKQGGSPEKK KSPPFIDFLK LNDIS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-30	14	114	7	107	B-MYB
1gv2_A	8e-30	14	114	4	104	MYB PROTO-ONCOGENE PROTEIN
1h88_C	4e-29	14	114	58	158	MYB PROTO-ONCOGENE PROTEIN
1h89_C	4e-29	14	114	58	158	MYB PROTO-ONCOGENE PROTEIN
1mse_C	7e-30	14	114	4	104	C-Myb DNA-Binding Domain
1msf_C	7e-30	14	114	4	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006434346.1	7e-59	transcription factor MYB115
Refseq	XP_006473036.1	6e-59	transcription factor MYB115-like
Swissprot	Q5NBM8	3e-56	CSA_ORYSJ; Transcription factor CSA
TrEMBL	A0A0K9P716	1e-150	A0A0K9P716_ZOSMR; Uncharacterized protein
STRING	XP_006473036.1	2e-58	(Citrus sinensis)
STRING	XP_006434346.1	3e-58	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP294	38	260

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69560.1	8e-56	myb domain protein 105

Link Out ? help Back to Top
Phytozome	Zosma34g00830.1

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420]