![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma3972g00010.1 | ||||||||
| Common Name | ZOSMA_3972G00010 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 131aa MW: 15416 Da PI: 10.7589 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 51.6 | 1.2e-16 | 11 | 51 | 3 | 43 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
i+n+ r tf kRr+g++KK +ELS+LCd++++ ++fs+
Zosma3972g00010.1 11 IQNDAARRATFEKRRKGLIKKVSELSTLCDVKACALVFSPY 51
89*************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 17.941 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.1E-24 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.6E-12 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 2.22E-27 | 3 | 86 | No hit | No description |
| SuperFamily | SSF55455 | 5.89E-25 | 3 | 95 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.7E-18 | 11 | 51 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.6E-12 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.6E-12 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MVRKKVKLVW IQNDAARRAT FEKRRKGLIK KVSELSTLCD VKACALVFSP YDTAPEIWPQ 60 DNQDVMRVLG RFRNMPEMEQ SKKMLNQEGF LRNRIGKLHE QLHKLNSENR ETKLHKVTDE 120 PVHGWRKAYR * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009376202.1 | 8e-48 | PREDICTED: agamous-like MADS-box protein AGL80 | ||||
| Swissprot | Q9FJK3 | 4e-36 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
| TrEMBL | A0A0K9P4B1 | 2e-92 | A0A0K9P4B1_ZOSMR; Uncharacterized protein | ||||
| STRING | XP_009376202.1 | 3e-47 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP363 | 36 | 202 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48670.1 | 2e-38 | AGAMOUS-like 80 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma3972g00010.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




