![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma3g01340.1 | ||||||||
| Common Name | ZOSMA_3G01340 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 167aa MW: 17816.7 Da PI: 5.8181 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 182.6 | 3.2e-57 | 31 | 127 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vreqdr+lPian+srimkk+lP n+ki+kdaketvqecvsefisfvtseasdkcqrekrktingddllwa+ tlGfe+y++plk+yl+kyre+eg
Zosma3g01340.1 31 VREQDRYLPIANISRIMKKALPLNGKIAKDAKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMVTLGFEEYIDPLKAYLQKYRETEG 125
69********************************************************************************************* PP
NF-YB 96 ek 97
++
Zosma3g01340.1 126 DS 127
97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.3E-55 | 29 | 138 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.05E-40 | 34 | 146 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.5E-27 | 37 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.0E-21 | 65 | 83 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 68 | 84 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.0E-21 | 84 | 102 | No hit | No description |
| PRINTS | PR00615 | 2.0E-21 | 103 | 121 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MADEPSSPAG GGVGSPESGG GAGGDLSPRN VREQDRYLPI ANISRIMKKA LPLNGKIAKD 60 AKETVQECVS EFISFVTSEA SDKCQREKRK TINGDDLLWA MVTLGFEEYI DPLKAYLQKY 120 RETEGDSKGS GKKDSGAQGG SQPGPSVQNY QQGSFGQGMH HTYSQP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 4e-48 | 30 | 122 | 1 | 93 | NF-YB |
| 4awl_B | 3e-48 | 30 | 122 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 3e-48 | 30 | 122 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014496345.1 | 4e-79 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_017418856.1 | 4e-79 | PREDICTED: nuclear transcription factor Y subunit B-10 | ||||
| Refseq | XP_027927125.1 | 3e-79 | nuclear transcription factor Y subunit B-10 | ||||
| Swissprot | Q67XJ2 | 3e-69 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | A0A0K9P622 | 1e-119 | A0A0K9P622_ZOSMR; Nuclear transcription factor Y subunit B-3 | ||||
| STRING | XP_007162720.1 | 2e-77 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 1e-64 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma3g01340.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




