![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma3g01640.1 | ||||||||
| Common Name | ZOSMA_3G01640 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 66aa MW: 7490.48 Da PI: 5.5618 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 44.1 | 5.7e-14 | 1 | 56 | 45 | 100 |
DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
+l++lp +ere+a++s+ eA r++ PvyG vg+i++lq++++++++el+++++e
Zosma3g01640.1 1 MLQKLPYNEREEAANSISHEAYLRVQHPVYGIVGTITNLQEEIHRKQQELVRIEAE 56
799***********************************************998876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03195 | 1.2E-11 | 1 | 53 | IPR004883 | Lateral organ boundaries, LOB |
| PROSITE profile | PS50891 | 10.411 | 1 | 57 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MLQKLPYNER EEAANSISHE AYLRVQHPVY GIVGTITNLQ EEIHRKQQEL VRIEAEIAIY 60 TAGNL* |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010927283.2 | 3e-16 | LOW QUALITY PROTEIN: LOB domain-containing protein 24-like | ||||
| TrEMBL | A0A0K9P676 | 7e-39 | A0A0K9P676_ZOSMR; Uncharacterized protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP27534 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26660.1 | 1e-14 | LOB domain-containing protein 24 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma3g01640.1 |




