![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma57g00570.1 | ||||||||
| Common Name | ZOSMA_57G00570 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 85aa MW: 9897.38 Da PI: 6.5954 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 102.9 | 2.3e-32 | 1 | 73 | 17 | 89 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89
m+++lP naki+k+aketvqecvsefisf+t+ea d+cqrekr+ ingddllw++ l fe y +lkv l +
Zosma57g00570.1 1 MRRALPFNAKITKEAKETVQECVSEFISFITGEAIDNCQREKRNLINGDDLLWSMNRLYFESYTISLKVNLVR 73
89******************************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 3.8E-16 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 2.01E-21 | 1 | 72 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 3.2E-28 | 1 | 72 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 9.0E-12 | 19 | 37 | No hit | No description |
| PRINTS | PR00615 | 9.0E-12 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 9.0E-12 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
MRRALPFNAK ITKEAKETVQ ECVSEFISFI TGEAIDNCQR EKRNLINGDD LLWSMNRLYF 60 ESYTISLKVN LVRSELILKY TFEN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 9e-26 | 1 | 73 | 17 | 89 | Transcription factor HapC (Eurofung) |
| 4g92_B | 9e-26 | 1 | 73 | 17 | 89 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003571418.1 | 2e-32 | nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | O23310 | 7e-33 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A0K9NVE2 | 8e-55 | A0A0K9NVE2_ZOSMR; Transcriptional activator hap3 | ||||
| STRING | BRADI3G15670.1 | 7e-32 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 3e-35 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma57g00570.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




