PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zosma57g00600.1

Common Name

ZOSMA_57G00600

Organism

Zostera marina

Taxonomic ID

29655

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera

Family

NF-YB

Protein Properties

Length: 84aa MW: 9138.6 Da PI: 11.0059

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zosma57g00600.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	76.5	3.8e-24	16	61	3	48
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvts 48 +drflPianvsrimk++lP nakisk+aket+qecvse++sf++ Zosma57g00600.1 16 SNDRFLPIANVSRIMKRALPINAKISKEAKETIQECVSEYVSFISV 61 68*****************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.5E-21	10	60	IPR009072	Histone-fold
SuperFamily	SSF47113	4.0E-15	17	60	IPR009072	Histone-fold
Pfam	PF00808	3.0E-14	20	62	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MVGSSSNSNS KRDAASNDRF LPIANVSRIM KRALPINAKI SKEAKETIQE CVSEYVSFIS 60 VKRLKSVTVR NVKLSTGMTF FGP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-18	16	82	3	75	Transcription factor HapC (Eurofung)
4g92_B	2e-18	16	82	3	75	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004139999.1	3e-24	PREDICTED: nuclear transcription factor Y subunit B-3
Refseq	XP_008464158.1	3e-24	PREDICTED: nuclear transcription factor Y subunit B-3
Refseq	XP_008464159.1	3e-24	PREDICTED: nuclear transcription factor Y subunit B-3
Refseq	XP_022140566.1	9e-25	nuclear transcription factor Y subunit B-3-like, partial
Swissprot	Q69J40	2e-23	NFYBA_ORYSJ; Nuclear transcription factor Y subunit B-10
TrEMBL	A0A0K9NVD7	2e-52	A0A0K9NVD7_ZOSMR; Nuclear transcription factor Y subunit B-3
STRING	XP_008464158.1	1e-23	(Cucumis melo)
STRING	XP_004139999.1	1e-23	(Cucumis sativus)
STRING	XP_004154508.1	1e-23	(Cucumis sativus)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-25	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	Zosma57g00600.1

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958]