![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zosma5g00940.1 | ||||||||
| Common Name | ZOSMA_5G00940 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 146aa MW: 16175.3 Da PI: 5.0433 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 144 | 3.4e-45 | 49 | 139 | 2 | 92 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
r qd +lPian+srim+k++P+ kiskd+k+++q cvsefisf+tseas kcq e+rkti+gddllwa+ lGf+dyv+plk+yl +yr+
Zosma5g00940.1 49 RPQDGHLPIANISRIMRKAVPETVKISKDSKDLIQTCVSEFISFITSEASLKCQTERRKTITGDDLLWAIEALGFQDYVNPLKLYLDRYRK 139
56999*************************************************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.1E-43 | 46 | 140 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.02E-34 | 51 | 140 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.0E-24 | 55 | 118 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.9E-15 | 82 | 100 | No hit | No description |
| PRINTS | PR00615 | 7.9E-15 | 101 | 119 | No hit | No description |
| PRINTS | PR00615 | 7.9E-15 | 120 | 138 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MNFPVVSMED KSPGSSSRTS AGKFRISDEA EAEDEAETSE IGGSARGERP QDGHLPIANI 60 SRIMRKAVPE TVKISKDSKD LIQTCVSEFI SFITSEASLK CQTERRKTIT GDDLLWAIEA 120 LGFQDYVNPL KLYLDRYRKQ VINLC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-38 | 49 | 139 | 3 | 93 | NF-YB |
| 4awl_B | 2e-38 | 49 | 139 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-38 | 49 | 139 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015872425.1 | 6e-45 | nuclear transcription factor Y subunit B-3-like | ||||
| Refseq | XP_015872426.1 | 6e-45 | nuclear transcription factor Y subunit B-3-like | ||||
| Refseq | XP_027366148.1 | 9e-45 | nuclear transcription factor Y subunit B-1-like | ||||
| Swissprot | Q9SLG0 | 6e-44 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A0K9NTY5 | 1e-103 | A0A0K9NTY5_ZOSMR; Nuclear transcription factor Y subunit B-1 | ||||
| STRING | XP_006485940.1 | 1e-43 | (Citrus sinensis) | ||||
| STRING | XP_006436200.1 | 1e-43 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP14056 | 13 | 26 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 3e-46 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Zosma5g00940.1 |




