PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zosma78g00370.1

Common Name

ZOSMA_78G00370

Organism

Zostera marina

Taxonomic ID

29655

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera

Family

Dof

Protein Properties

Length: 101aa MW: 11286.8 Da PI: 8.3669

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zosma78g00370.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	85.8	4e-27	26	83	3	61
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 +++ +cprCd+ +tk+C ny+ +qPryfC +Cr yWt+GG +rnvPvGgg rk+k+s Zosma78g00370.1 26 QTNHNCPRCDAPDTKLCTI-NYNHTQPRYFCMSCRGYWTNGGVFRNVPVGGGYRKHKNS 83 56789**********87.7*********************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02701	1.3E-22	28	82	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	21.026	29	82	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	1.0E-15	31	81	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MAEECYALTV GSMPSNLVNF IDGRVQTNHN CPRCDAPDTK LCTINYNHTQ PRYFCMSCRG 60 YWTNGGVFRN VPVGGGYRKH KNSYSKTSKI NLLSDEDITL *

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of abscisic acid-related genes (PubMed:22155632). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000269\|PubMed:22155632, ECO:0000269\|PubMed:30626969}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cytokinin in procambium. {ECO:0000269\|PubMed:30626969}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_190147.1	1e-20	Dof-type zinc finger DNA-binding family protein
Refseq	XP_023520188.1	5e-21	dof zinc finger protein DOF3.1-like
Swissprot	Q9M1E6	1e-21	DOF32_ARATH; Dof zinc finger protein DOF3.2
TrEMBL	A0A0K9NNB8	4e-70	A0A0K9NNB8_ZOSMR; Uncharacterized protein
STRING	AT3G45610.1	5e-20	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP140	37	367

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G45610.1	5e-24	Dof family protein

Link Out ? help Back to Top
Phytozome	Zosma78g00370.1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] de Lucas M, et al. Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation. Plant Cell, 2016. 28(10): p. 2616-2631 [PMID:27650334] Ravindran P,Verma V,Stamm P,Kumar PP A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor. Mol Plant, 2017. 10(10): p. 1307-1320 [PMID:28917589] Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]