PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00081.1.g00090.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 87aa    MW: 9179.42 Da    PI: 10.5908
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00081.1.g00090.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.94.9e-323585151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a++ifss+g+lyeys+
  Zpz_sc00081.1.g00090.1.sm.mk 35 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALVIFSSRGRLYEYSN 85
                                  79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-352886IPR002100Transcription factor, MADS-box
CDDcd002654.82E-352986No hitNo description
PRINTSPR004044.6E-292949IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-263386IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.9173387IPR002100Transcription factor, MADS-box
PfamPF003194.2E-273683IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-294964IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-296485IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MSSSPGSGSV GGASAAAAAA AAAENKAPGK GKQIKRIENT TNRQVTFCKR RNGLLKKAYE  60
LSVLCDAEIA LVIFSSRGRL YEYSNNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-193084458Myocyte-specific enhancer factor 2B
1tqe_Q4e-193084458Myocyte-specific enhancer factor 2B
1tqe_R4e-193084458Myocyte-specific enhancer factor 2B
1tqe_S4e-193084458Myocyte-specific enhancer factor 2B
3mu6_A4e-193084357Myocyte-specific enhancer factor 2A
3mu6_B4e-193084357Myocyte-specific enhancer factor 2A
3mu6_C4e-193084357Myocyte-specific enhancer factor 2A
3mu6_D4e-193084357Myocyte-specific enhancer factor 2A
6c9l_A4e-193084458Myocyte-specific enhancer factor 2B
6c9l_B4e-193084458Myocyte-specific enhancer factor 2B
6c9l_C4e-193084458Myocyte-specific enhancer factor 2B
6c9l_D4e-193084458Myocyte-specific enhancer factor 2B
6c9l_E4e-193084458Myocyte-specific enhancer factor 2B
6c9l_F4e-193084458Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00081.1.g00090.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0027253e-71KJ002725.1 Phyllostachys edulis MADS-box protein 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.11e-36MADS-box transcription factor 58
SwissprotP293851e-33AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLA0A368QCB73e-35A0A368QCB7_SETIT; Uncharacterized protein
TrEMBLK3ZAE52e-36K3ZAE5_SETIT; Uncharacterized protein
STRINGSi023516m3e-37(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.24e-34MIKC_MADS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  3. Rathnakumar K, et al.
    Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability.
    J. Thromb. Haemost., 2016. 14(8): p. 1655-67
    [PMID:27241812]
  4. Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L
    Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks.
    Development, 2016. 143(18): p. 3372-81
    [PMID:27510967]
  5. Ehlers K, et al.
    The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana.
    PLoS ONE, 2016. 11(10): p. e0165075
    [PMID:27776173]
  6. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  7. Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
    Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers.
    Development, 2018.
    [PMID:29361563]