![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc00298.1.g00340.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 88aa MW: 10016.3 Da PI: 11.0972 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 48.9 | 1.4e-15 | 21 | 63 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47
+r++r++kNRe+A rsR+RK a++ eLe+kv Le+eN++L+
Zpz_sc00298.1.g00340.1.sm.mk 21 RRQKRMIKNRESAARSRARKMAYTSELETKVSRLEEENERLRR 63
79***************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 7.4E-16 | 15 | 64 | No hit | No description |
| SMART | SM00338 | 4.9E-11 | 15 | 77 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.45 | 19 | 64 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 5.64E-17 | 21 | 67 | No hit | No description |
| SuperFamily | SSF57959 | 2.63E-12 | 21 | 65 | No hit | No description |
| Pfam | PF00170 | 1.6E-13 | 21 | 63 | IPR004827 | Basic-leucine zipper domain |
| PROSITE pattern | PS00036 | 0 | 24 | 39 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MTAPGRKRGT TGYVEDKLME RRQKRMIKNR ESAARSRARK MAYTSELETK VSRLEEENER 60 LRRQKVEVIS FAEDAAGRAA SQQGAGVT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc00298.1.g00340.1.sm.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025818579.1 | 3e-28 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2 | ||||
| Swissprot | Q9LES3 | 1e-24 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
| TrEMBL | A0A2T7DFC8 | 1e-26 | A0A2T7DFC8_9POAL; Uncharacterized protein | ||||
| STRING | OS01T0813100-00 | 3e-27 | (Oryza sativa) | ||||
| STRING | Traes_3AL_58F294736.2 | 1e-27 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2707 | 38 | 83 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G56850.1 | 2e-18 | ABA-responsive element binding protein 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




