PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00346.1.g00070.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 67aa    MW: 7703.7 Da    PI: 4.7147
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00346.1.g00070.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM64.24.1e-201864148
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                  +ppGfrFhPtdeelv++yL+kkv+++k++l ++ik+vd+yk+ePwdL+
  Zpz_sc00346.1.g00070.1.sm.mk 18 VPPGFRFHPTDEELVDYYLRKKVASNKIDL-DIIKDVDLYKIEPWDLQ 64
                                  69****************************.99**************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-201165IPR003441NAC domain
PROSITE profilePS5100522.0451867IPR003441NAC domain
PfamPF023651.7E-91961IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MHACPESVVN KMDGSSHVPP GFRFHPTDEE LVDYYLRKKV ASNKIDLDII KDVDLYKIEP  60
WDLQGDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-1517631460Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00346.1.g00070.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750931e-47KT075093.1 Panicum virgatum secondary wall NAC master switch (SWN8B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021314804.16e-30uncharacterized protein LOC8078886 isoform X2
SwissprotQ9FWX26e-26NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A1D6Q6285e-28A0A1D6Q628_MAIZE; Putative NAC domain transcription factor superfamily protein
TrEMBLA0A438K3B45e-28A0A438K3B4_VITVI; NAC domain-containing protein 7
STRINGPavir.J39804.1.p1e-27(Panicum virgatum)
STRINGORGLA04G0171200.12e-28(Oryza glaberrima)
STRINGSb04g033570.11e-27(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16506913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-17NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]