![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc00453.1.g00010.1.am.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 137aa MW: 15110 Da PI: 6.0081 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 161.6 | 1.2e-50 | 25 | 113 | 2 | 90 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvep 82
+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p
Zpz_sc00453.1.g00010.1.am.mk 25 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDP 105
89******************************************************************************* PP
NF-YB 83 lkvylkky 90
++ yl+
Zpz_sc00453.1.g00010.1.am.mk 106 MRRYLHXX 113
*****975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.9E-47 | 21 | 119 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.74E-36 | 27 | 121 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.0E-27 | 30 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.4E-14 | 58 | 76 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.4E-14 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 4.4E-14 | 96 | 114 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
MADHHGQEDD DGRRAGGAGA AEEIKEQDRL LPIANVGRIM KQILPPNAKI SKEAKETMQE 60 CVSEFISFVT GEASDKCHKE KRKTVNGDDV CWAFGALGFD DYVDPMRRYL HXXXXAREGH 120 RTTPPPARAP PPDPAAP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 7e-41 | 19 | 111 | 1 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc00453.1.g00010.1.am.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU970198 | 1e-132 | EU970198.1 Zea mays clone 342117 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002459056.1 | 8e-63 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_004971188.1 | 8e-63 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | O82248 | 2e-52 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A368RFG3 | 2e-61 | A0A368RFG3_SETIT; Uncharacterized protein | ||||
| TrEMBL | C5XH51 | 2e-61 | C5XH51_SORBI; Uncharacterized protein | ||||
| TrEMBL | K3XSH5 | 1e-60 | K3XSH5_SETIT; Uncharacterized protein | ||||
| STRING | Pavir.Ea03968.1.p | 5e-64 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 3e-54 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




