![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc00527.1.g00030.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 145aa MW: 16370.4 Da PI: 4.4665 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 128.4 | 2.4e-40 | 1 | 73 | 30 | 102 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
+kadedv+misaeaPv+++kace+fileltlrsw+h+eenkrrtl+k+diaaa+trtdi+dflvdivprd++k
Zpz_sc00527.1.g00030.1.sm.mk 1 MKADEDVRMISAEAPVVFAKACEIFILELTLRSWMHTEENKRRTLQKNDIAAAITRTDIYDFLVDIVPRDDMK 73
9*********************************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.8E-30 | 1 | 69 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.84E-23 | 1 | 69 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.7E-14 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MKADEDVRMI SAEAPVVFAK ACEIFILELT LRSWMHTEEN KRRTLQKNDI AAAITRTDIY 60 DFLVDIVPRD DMKEEGVGLP SVGVPPMQGH PAAYPYYYGP QQQMAGAGMV YGGQQGHPVT 120 YMWQEPHEQQ EQQATEEQRS LPESG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 7e-43 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 41 | 47 | RRTLQKN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:26542958). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:26542958}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc00527.1.g00030.1.sm.mk |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF939122 | 1e-161 | KF939122.1 Cynodon dactylon nuclear factor Y subunit C (NF-YC) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020188795.1 | 6e-77 | nuclear transcription factor Y subunit C-4-like | ||||
| Swissprot | Q655V5 | 3e-75 | NFYC4_ORYSJ; Nuclear transcription factor Y subunit C-4 | ||||
| TrEMBL | A0A0H3U6T2 | 2e-91 | A0A0H3U6T2_CYNDA; Nuclear factor Y subunit C | ||||
| STRING | MLOC_53118.1 | 7e-77 | (Hordeum vulgare) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2703 | 37 | 90 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 8e-49 | nuclear factor Y, subunit C2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




