![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc00553.1.g00040.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 109aa MW: 12313 Da PI: 8.2578 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 78.9 | 8e-25 | 38 | 97 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
Fl+k+y++++d++++ ++sws ++nsfvv+d++ f + +Lp+yFkh+nf+SFvRQLn+Y+
Zpz_sc00553.1.g00040.1.sm.mk 38 FLTKTYDMIDDPTTDAVVSWSCTNNSFVVWDPHIFGTVLLPRYFKHNNFSSFVRQLNTYE 97
9********************888***********************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.6E-26 | 32 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 5.0E-24 | 34 | 109 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.36E-23 | 36 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 3.6E-16 | 38 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 6.2E-21 | 38 | 97 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.6E-16 | 76 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.6E-16 | 89 | 101 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MNHRMVNPVK VESQQSLGAA NGHPLPMDGL HDGGPPPFLT KTYDMIDDPT TDAVVSWSCT 60 NNSFVVWDPH IFGTVLLPRY FKHNNFSSFV RQLNTYEKRG HCKADLVKK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 1e-18 | 36 | 99 | 27 | 90 | Heat shock factor protein 1 |
| 5d5v_B | 1e-18 | 36 | 99 | 27 | 90 | Heat shock factor protein 1 |
| 5d5v_D | 1e-18 | 36 | 99 | 27 | 90 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE). Involved in heat stress response. {ECO:0000269|PubMed:18064488}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc00553.1.g00040.1.sm.mk |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC092076 | 1e-46 | AC092076.7 Oryza sativa chromosome 3 BAC OSJNBb0021G19 genomic sequence, complete sequence. | |||
| GenBank | AK068660 | 1e-46 | AK068660.1 Oryza sativa Japonica Group cDNA clone:J013162K14, full insert sequence. | |||
| GenBank | AP014959 | 1e-46 | AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CT829361 | 1e-46 | CT829361.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI220A14, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004981438.2 | 6e-56 | heat stress transcription factor A-2e | ||||
| Swissprot | Q6F388 | 5e-55 | HFA2E_ORYSJ; Heat stress transcription factor A-2e | ||||
| TrEMBL | K4AC79 | 1e-54 | K4AC79_SETIT; Uncharacterized protein | ||||
| STRING | Pavir.J04151.1.p | 3e-57 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP308 | 37 | 231 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G22830.1 | 3e-38 | heat shock transcription factor A6B | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




