![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc00695.1.g00030.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 130aa MW: 14906.7 Da PI: 6.7795 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 143.2 | 6.4e-45 | 3 | 96 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84
++qd++lPianv+rimk vlP +akisk aket+qec +e ++fvt+eas++c+re+rktingdd+++a+ +lG+++y+++++
Zpz_sc00695.1.g00030.1.sm.mk 3 SAQDNLLPIANVGRIMKDVLPPQAKISKSAKETIQECTTELVGFVTGEASERCRRERRKTINGDDICHAMRSLGLDHYADAMR 85
579******************************************************************************** PP
NF-YB 85 vylkkyreleg 95
yl++yre e+
Zpz_sc00695.1.g00030.1.sm.mk 86 RYLQRYRESEE 96
********885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.8E-40 | 3 | 103 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.06E-33 | 5 | 104 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.1E-23 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 6.6E-14 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 6.6E-14 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 6.6E-14 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MNSAQDNLLP IANVGRIMKD VLPPQAKISK SAKETIQECT TELVGFVTGE ASERCRRERR 60 KTINGDDICH AMRSLGLDHY ADAMRRYLQR YRESEELAAE LNRSSGREIQ IDVRDELSIF 120 RGSEQHQDRN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-37 | 5 | 93 | 4 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-37 | 5 | 93 | 4 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc00695.1.g00030.1.sm.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001266909.1 | 2e-73 | uncharacterized protein LOC101027253 | ||||
| Swissprot | O04027 | 9e-43 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A2T7DBX6 | 3e-74 | A0A2T7DBX6_9POAL; Uncharacterized protein | ||||
| STRING | GRMZM2G169884_P01 | 8e-73 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 4e-45 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




