![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc00802.1.g00060.1.sm.mkhc | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 217aa MW: 24042.2 Da PI: 9.9745 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 94.9 | 1.3e-29 | 5 | 77 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v + + v +kk Lvfy g+apkg kt+W+mheyrl
Zpz_sc00802.1.g00060.1.sm.mkhc 5 GEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPVGA--PRPVAIKKALVFYAGKAPKGDKTNWIMHEYRL 77
579************************************99..779***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 40.104 | 1 | 104 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.2E-35 | 3 | 104 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.2E-14 | 9 | 77 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 217 aa Download sequence Send to blast |
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPVGAPRPVA IKKALVFYAG 60 KAPKGDKTNW IMHEYRLADV DRSARNKNSS LRLDDWVLCR IYNKKSASEK LATEVHSPAK 120 QKPAAVLLPP PSTDAGFAPP PTFPELQAAY HEVRPSTDSV PRAHGTDTSC SGQTSAERPE 180 VQNQPKLAEW ERAFAPGVNL AGPMLHDVFT YWGSKPF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-50 | 2 | 110 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-50 | 2 | 110 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-50 | 2 | 110 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-50 | 2 | 110 | 66 | 171 | NO APICAL MERISTEM PROTEIN |
| 4dul_A | 3e-50 | 2 | 110 | 66 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 3e-50 | 2 | 110 | 66 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc00802.1.g00060.1.sm.mkhc |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK376931 | 1e-143 | AK376931.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3144G06. | |||
| GenBank | BT037323 | 1e-143 | BT037323.1 Zea mays full-length cDNA clone ZM_BFb0162P01 mRNA, complete cds. | |||
| GenBank | KJ727956 | 1e-143 | KJ727956.1 Zea mays clone pUT6054 NAC transcription factor (NAC20) mRNA, partial cds. | |||
| GenBank | KM987612 | 1e-143 | KM987612.1 Zea mays NAC protein (SNAC052) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004962039.1 | 1e-103 | NAC domain-containing protein 48 | ||||
| Swissprot | Q7F2L3 | 3e-82 | NAC48_ORYSJ; NAC domain-containing protein 48 | ||||
| TrEMBL | A0A368QIL7 | 1e-103 | A0A368QIL7_SETIT; Uncharacterized protein | ||||
| STRING | Si022381m | 1e-102 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP28092 | 3 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01720.1 | 6e-79 | NAC family protein | ||||




