![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc01147.1.g00170.1.sm.mkhc | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 116aa MW: 13386.4 Da PI: 9.7628 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.5 | 6.2e-32 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rienk nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs +gklyeyss
Zpz_sc01147.1.g00170.1.sm.mkhc 10 RIENKVNRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSAKGKLYEYSS 59
8***********************************************96 PP
| |||||||
| 2 | K-box | 17.6 | 1.7e-07 | 86 | 115 | 67 | 96 |
K-box 67 skKnellleqieelqkkekelqeenkaLrk 96
+ +n+l++++i elqkkek+l ++n aL+k
Zpz_sc01147.1.g00170.1.sm.mkhc 86 ADQNQLMFDSIFELQKKEKMLIDQNGALQK 115
679**********************99986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.057 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 5.5E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.36E-42 | 2 | 74 | No hit | No description |
| SuperFamily | SSF55455 | 6.15E-33 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.1E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MGRGPVQLRR IENKVNRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFSA KGKLYEYSSH 60 ASMEGILERY HRYSFEERAA LDPTVADQNQ LMFDSIFELQ KKEKMLIDQN GALQKL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc01147.1.g00170.1.sm.mkhc |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ430695 | 5e-89 | AJ430695.1 Zea mays mRNA for putative MADS-domain transcription factor (m28 gene). | |||
| GenBank | BT033397 | 5e-89 | BT033397.1 Zea mays full-length cDNA clone ZM_BFb0049C14 mRNA, complete cds. | |||
| GenBank | BT065179 | 5e-89 | BT065179.1 Zea mays full-length cDNA clone ZM_BFb0021C02 mRNA, complete cds. | |||
| GenBank | BT088075 | 5e-89 | BT088075.1 Zea mays full-length cDNA clone ZM_BFc0004L03 mRNA, complete cds. | |||
| GenBank | EU962906 | 5e-89 | EU962906.1 Zea mays clone 246416 MADS-box transcription factor 18 mRNA, complete cds. | |||
| GenBank | KJ727572 | 5e-89 | KJ727572.1 Zea mays clone pUT5432 MADS transcription factor (MADS67) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002460989.1 | 4e-55 | MADS-box transcription factor 18 | ||||
| Swissprot | A2YNI2 | 6e-53 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
| Swissprot | Q0D4T4 | 6e-53 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
| TrEMBL | A0A3L6E5V6 | 4e-54 | A0A3L6E5V6_MAIZE; MADS-box transcription factor 18 | ||||
| TrEMBL | C5XDW7 | 8e-54 | C5XDW7_SORBI; Uncharacterized protein | ||||
| STRING | Sb02g038780.1 | 1e-54 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1151 | 37 | 113 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69120.1 | 5e-42 | MIKC_MADS family protein | ||||




