![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc01287.1.g00110.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | ARR-B | ||||||||
| Protein Properties | Length: 158aa MW: 17923.2 Da PI: 5.6589 | ||||||||
| Description | ARR-B family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 29.9 | 1.3e-09 | 131 | 152 | 1 | 22 |
G2-like 1 kprlrWtpeLHerFveaveqLG 22
kpr++W+ eLH++Fv av+qLG
Zpz_sc01287.1.g00110.1.sm.mk 131 KPRVVWSVELHRKFVAAVNQLG 152
79*******************6 PP
| |||||||
| 2 | Response_reg | 28.3 | 8.8e-11 | 1 | 53 | 56 | 109 |
SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
Response_reg 56 mdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
mdG++ll+ e++lp+i+++ +ge + + + + Ga d+l Kp+ +eel++
Zpz_sc01287.1.g00110.1.sm.mk 1 MDGFKLLELVGL-EMDLPVIMLSVNGETKSVMKGITHGACDYLLKPVRIEELRN 53
788888876644.569************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:3.40.50.2300 | 3.0E-18 | 1 | 84 | No hit | No description |
| Pfam | PF00072 | 1.8E-7 | 1 | 54 | IPR001789 | Signal transduction response regulator, receiver domain |
| PROSITE profile | PS50110 | 21.72 | 1 | 59 | IPR001789 | Signal transduction response regulator, receiver domain |
| SuperFamily | SSF52172 | 1.15E-13 | 1 | 71 | IPR011006 | CheY-like superfamily |
| CDD | cd00156 | 1.49E-10 | 1 | 58 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.9E-9 | 129 | 155 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MDGFKLLELV GLEMDLPVIM LSVNGETKSV MKGITHGACD YLLKPVRIEE LRNIWQHVVR 60 RKFSSREHKN LDMYKEPPTA DSCNGQSQIV SRASDQSGRL SKKRKELHSE EEDDVDETDF 120 QEGDEPSAAK KPRVVWSVEL HRKFVAAVNQ LGIDSNDS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}. | |||||
| UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc01287.1.g00110.1.sm.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004964668.1 | 7e-85 | two-component response regulator ORR22 | ||||
| Swissprot | B8B3I4 | 9e-76 | ORR22_ORYSI; Two-component response regulator ORR22 | ||||
| Swissprot | Q5SML5 | 9e-76 | ORR22_ORYSJ; Two-component response regulator ORR22 | ||||
| TrEMBL | A0A0A9B775 | 1e-87 | A0A0A9B775_ARUDO; Two-component response regulator | ||||
| STRING | Pavir.Da02067.1.p | 4e-85 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1856 | 38 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G25180.1 | 2e-45 | response regulator 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




