![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc01417.1.g00180.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 114aa MW: 11909.5 Da PI: 8.5066 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 74.3 | 2.1e-23 | 67 | 114 | 2 | 49 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49
C v+gC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsr+
Zpz_sc01417.1.g00180.1.sm.mk 67 CAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRY 114
**********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.1E-26 | 59 | 114 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 20.503 | 64 | 114 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.94E-22 | 65 | 114 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 6.9E-18 | 67 | 113 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MDWDLKVPAS WDLAELEHDA GAAAAPAAGP SGVHRVNAAV TTGGGVGAPR RPRPAGGGGA 60 GQQCPSCAVD GCKADLSKCR DYHRRHKVCE AHSKTPVVVV AGREMRFCQQ CSRY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj0_A | 6e-17 | 67 | 114 | 6 | 53 | squamosa promoter-binding protein-like 12 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | SBP transcriptional regulator probably involved in the domestication of maize. Acts as a transcriptional repressor binding to a 5'-GTAC-3' motif. May repress the growth of lateral branches in length and numbers. {ECO:0000250|UniProtKB:Q49I55}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc01417.1.g00180.1.sm.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP094913 | 9e-69 | FP094913.1 Phyllostachys edulis cDNA clone: bphyem212i14, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025876170.1 | 2e-39 | squamosa promoter-binding-like protein 18 isoform X3 | ||||
| Swissprot | Q49I57 | 2e-36 | TGA1B_MAIZE; Teosinte glume architecture 1 | ||||
| TrEMBL | A0A0F7LF00 | 9e-39 | A0A0F7LF00_ZEAMM; TGA1 (Fragment) | ||||
| TrEMBL | A0A287ECT5 | 6e-38 | A0A287ECT5_HORVV; Uncharacterized protein | ||||
| TrEMBL | K3YHM9 | 4e-37 | K3YHM9_SETIT; Uncharacterized protein | ||||
| STRING | Si013747m | 6e-38 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1755 | 37 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G50670.1 | 7e-23 | SBP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




