![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc01417.1.g00200.1.sm.mkhc | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 193aa MW: 22182.5 Da PI: 4.8206 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 76.3 | 2.4e-24 | 45 | 94 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+ rqv fskRr+g++KKA+EL LCda+va+i+fs+ g+lye++s
Zpz_sc01417.1.g00200.1.sm.mkhc 45 RIEDRVSRQVRFSKRRKGLFKKAFELAELCDAQVALIVFSPAGRLYEFAS 94
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 28.287 | 36 | 96 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.0E-30 | 36 | 95 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.09E-34 | 38 | 106 | No hit | No description |
| SuperFamily | SSF55455 | 1.09E-27 | 38 | 113 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-25 | 38 | 58 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.0E-24 | 45 | 92 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-25 | 58 | 73 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-25 | 73 | 94 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 193 aa Download sequence Send to blast |
MDAEEARNPE LRQREEEARA GCEGDGRDEM KKAAKKKRGR VEMRRIEDRV SRQVRFSKRR 60 KGLFKKAFEL AELCDAQVAL IVFSPAGRLY EFASSNSSIE TIFDRYWNLA NTTNDLNIEV 120 RDSQNDCNMQ REQSSASSFS DHLNNIAQWV LEPNLNDLNV DELREYTADE GDWASSNSWL 180 VMKSFGSSIK EGD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n6j_A | 9e-15 | 38 | 96 | 2 | 60 | Myocyte-specific enhancer factor 2B |
| 1n6j_B | 9e-15 | 38 | 96 | 2 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_P | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 7e-15 | 38 | 96 | 3 | 61 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc01417.1.g00200.1.sm.mkhc |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025820080.1 | 2e-61 | MADS-box transcription factor 51-like isoform X1 | ||||
| Refseq | XP_025820081.1 | 2e-61 | MADS-box transcription factor 51-like isoform X1 | ||||
| Swissprot | Q9XJ61 | 2e-34 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | A0A2T7D9Y5 | 6e-61 | A0A2T7D9Y5_9POAL; Uncharacterized protein | ||||
| STRING | Si014540m | 2e-58 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30260.1 | 4e-29 | AGAMOUS-like 79 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




