![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc01467.1.g00040.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 90aa MW: 10487.2 Da PI: 10.0252 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.4 | 2.8e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
Zpz_sc01467.1.g00040.1.sm.mk 15 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.6E-22 | 10 | 65 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 22.754 | 10 | 66 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.6E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.1E-15 | 15 | 62 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.54E-21 | 17 | 90 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.86E-10 | 18 | 62 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 7.7E-8 | 66 | 89 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 7.165 | 67 | 90 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MGCRSCEKPK MNYRKGLWSP EEDQRLRDYI LKHGLGCWSA VPAKAGLQRN GKSCRLRWIN 60 YLRPGLKRGM FSQEEEDIVI DLQAKLGNKY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 2e-13 | 9 | 90 | 23 | 101 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc01467.1.g00040.1.sm.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020177025.1 | 9e-62 | transcription factor MYB6-like | ||||
| Swissprot | Q8LPH6 | 7e-37 | MYB86_ARATH; Transcription factor MYB86 | ||||
| TrEMBL | A0A453MV07 | 2e-60 | A0A453MV07_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A453MV82 | 1e-60 | A0A453MV82_AEGTS; Uncharacterized protein | ||||
| STRING | Sb04g001110.1 | 4e-61 | (Sorghum bicolor) | ||||
| STRING | TRIUR3_11495-P1 | 6e-61 | (Triticum urartu) | ||||
| STRING | GRMZM2G088189_P01 | 5e-61 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1707 | 37 | 109 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26660.1 | 3e-39 | myb domain protein 86 | ||||




