![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc02307.1.g00020.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 171aa MW: 18406.3 Da PI: 6.0225 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 173.8 | 1.8e-54 | 24 | 119 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvep 82
+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyvep
Zpz_sc02307.1.g00020.1.sm.mk 24 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETIQECVSEFISFVTGEASDKCRKEKRKTVNGDDVCWAFGALGFDDYVEP 104
89******************************************************************************* PP
NF-YB 83 lkvylkkyrelegek 97
++ yl+++re+eg++
Zpz_sc02307.1.g00020.1.sm.mk 105 MRRYLHRFREVEGDR 119
*************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.3E-50 | 19 | 130 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.02E-38 | 26 | 135 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.5E-26 | 29 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-16 | 57 | 75 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.3E-16 | 76 | 94 | No hit | No description |
| PRINTS | PR00615 | 2.3E-16 | 95 | 113 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 171 aa Download sequence Send to blast |
MADHLGQPDD DGRRAAGSAA EEIKEQDRLL PIANVGRIMK QILPPNAKIS KEAKETIQEC 60 VSEFISFVTG EASDKCRKEK RKTVNGDDVC WAFGALGFDD YVEPMRRYLH RFREVEGDRA 120 AAAASSRGAG EGPDHHTSGS GAGGAGPSGT GHFMFGAMDR SDNSTSSSRQ F |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-44 | 23 | 114 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc02307.1.g00020.1.sm.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU970198 | 1e-131 | EU970198.1 Zea mays clone 342117 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015635864.1 | 9e-77 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_015635872.1 | 9e-77 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | O82248 | 2e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | Q75IZ7 | 4e-55 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A0E0JTD0 | 1e-79 | A0A0E0JTD0_ORYPU; Uncharacterized protein | ||||
| STRING | OPUNC01G42210.1 | 2e-80 | (Oryza punctata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 2e-56 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




