![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc02595.1.g00060.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | LFY | ||||||||
| Protein Properties | Length: 133aa MW: 14980.3 Da PI: 9.89 | ||||||||
| Description | LFY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FLO_LFY | 239.8 | 1.3e-73 | 17 | 123 | 280 | 386 |
FLO_LFY 280 kvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfn 360
+vtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+didavf+
Zpz_sc02595.1.g00060.1.sm.mk 17 QVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGFDIDAVFA 97
7******************************************************************************** PP
FLO_LFY 361 ahprLsiWYvPtkLrqLChlerskas 386
ahprLsiWYvPt+LrqLCh++r+ ++
Zpz_sc02595.1.g00060.1.sm.mk 98 AHPRLSIWYVPTRLRQLCHQARNGHA 123
**********************9775 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF01698 | 1.1E-74 | 16 | 123 | IPR002910 | Floricaula/leafy protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0031490 | Molecular Function | chromatin DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0043621 | Molecular Function | protein self-association | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MAGENRTAVT LFVLVAQVTN QVFRYAKKCG ASYINKPKMR HYVHCYALHC LDEEASNALR 60 RAYKARGENV GAWRQACYAP LVEIAARHGF DIDAVFAAHP RLSIWYVPTR LRQLCHQARN 120 GHATAGLPPP PMF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2vy1_A | 1e-64 | 16 | 120 | 57 | 161 | PROTEIN LEAFY |
| 2vy2_A | 1e-64 | 16 | 120 | 57 | 161 | PROTEIN LEAFY |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}. | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00095 | SELEX | Transfer from AT5G61850 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc02595.1.g00060.1.sm.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF184957 | 1e-148 | KF184957.1 Saccharum hybrid cultivar R570 clone BAC 011C13 sequence, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025826267.1 | 2e-77 | probable transcription factor FL | ||||
| Swissprot | A2XX39 | 1e-69 | FL_ORYSI; Probable transcription factor FL | ||||
| Swissprot | Q0JAI1 | 1e-69 | FL_ORYSJ; Probable transcription factor FL | ||||
| TrEMBL | A0A1E5W6A3 | 4e-78 | A0A1E5W6A3_9POAL; Putative transcription factor FL | ||||
| STRING | Pavir.Gb00795.1.p | 1e-77 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP8269 | 36 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G61850.1 | 3e-68 | floral meristem identity control protein LEAFY (LFY) | ||||




