![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc02836.1.g00010.1.am.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 163aa MW: 17616.8 Da PI: 9.0036 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 57 | 2.7e-18 | 80 | 113 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C++C+ +Tp+WR gp g+ktLCnaCG++y++ +
Zpz_sc02836.1.g00010.1.am.mk 80 CTHCQIESTPQWRAGPLGPKTLCNACGVRYKSGR 113
*******************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 4.61E-15 | 73 | 136 | No hit | No description |
| PROSITE profile | PS50114 | 11.543 | 74 | 110 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 1.0E-15 | 74 | 124 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 6.7E-15 | 78 | 111 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 5.40E-14 | 79 | 136 | No hit | No description |
| Pfam | PF00320 | 6.8E-16 | 80 | 114 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 80 | 105 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007623 | Biological Process | circadian rhythm | ||||
| GO:0009845 | Biological Process | seed germination | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
AVEPPTILVP TPMYSAASSH SDPESIAESN PDPAPPKKKK KAKKPAPAPA ASDAEGDADG 60 DADYVEGGER SWPQGAVRRC THCQIESTPQ WRAGPLGPKT LCNACGVRYK SGRLFPEYRP 120 AASPTFVPSI HSNSHKKVVE MRQKAVRSGD PSCDLLQFIR RRD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc02836.1.g00010.1.am.mk |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT054269 | 1e-157 | BT054269.1 Zea mays full-length cDNA clone ZM_BFb0206G24 mRNA, complete cds. | |||
| GenBank | BT055755 | 1e-157 | BT055755.1 Zea mays full-length cDNA clone ZM_BFb0170C21 mRNA, complete cds. | |||
| GenBank | BT067067 | 1e-157 | BT067067.1 Zea mays full-length cDNA clone ZM_BFb0175B18 mRNA, complete cds. | |||
| GenBank | EU967675 | 1e-157 | EU967675.1 Zea mays clone 305252 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025807686.1 | 2e-89 | GATA transcription factor 8-like | ||||
| Refseq | XP_025807694.1 | 2e-89 | GATA transcription factor 8-like | ||||
| Swissprot | O82632 | 7e-37 | GATA9_ARATH; GATA transcription factor 9 | ||||
| TrEMBL | A0A2T7FDI5 | 4e-88 | A0A2T7FDI5_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T8KYD8 | 5e-88 | A0A2T8KYD8_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Ab03246.1.p | 1e-87 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5169 | 34 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 7e-39 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




