PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zpz_sc02852.1.g00070.1.sm.mkhc

Organism

Zoysia pacifica

Taxonomic ID

1070856

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

MYB_related

Protein Properties

Length: 130aa MW: 14431.5 Da PI: 9.6116

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zpz_sc02852.1.g00070.1.sm.mkhc	genome	ZGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.3	8.5e-19	28	72	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T eEd++++++++ lG++ W++Ia +++ gRt++++k++w+++ Zpz_sc02852.1.g00070.1.sm.mkhc 28 RGNFTDEEDDIIIKLHQILGNK-WSLIAGRLP-GRTDNEIKNYWNTH 72 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	4.321	1	22	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	8.6E-13	8	35	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.91E-24	8	80	IPR009057	Homeodomain-like
PROSITE profile	PS51294	28.012	23	77	IPR017930	Myb domain
SMART	SM00717	2.6E-17	27	75	IPR001005	SANT/Myb domain
Pfam	PF00249	9.7E-17	28	72	IPR001005	SANT/Myb domain
CDD	cd00167	5.16E-14	30	73	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.0E-25	36	74	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MLEAAGLQRC GKSCRLRWIN YLRPDLKRGN FTDEEDDIII KLHQILGNKW SLIAGRLPGR 60 TDNEIKNYWN THIKRKLLAR GIDPKTHRPL SVTAAGAPPS SGGHSSDEDY SMSVPNLGGI 120 DLNLSLSLPS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-24	9	77	40	108	B-MYB
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Zpz_sc02852.1.g00070.1.sm.mkhc

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By light, UV, cold, drought, ethylene, jasmonic acid (JA), salicylic acid (SA), abscisic acid (ABA), cadmium (CdCl(2)), high salt (NaCl), and cytokinins. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM156905	9e-86	AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).
GenBank	EU963911	9e-86	EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds.
GenBank	HQ858692	9e-86	HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004977234.1	2e-65	myb-related protein Zm38
Swissprot	O49608	4e-53	MYB32_ARATH; Transcription factor MYB32
TrEMBL	K3YA56	4e-64	K3YA56_SETIT; Uncharacterized protein
STRING	Si011098m	7e-65	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	1e-54	myb domain protein 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]