![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc03262.1.g00070.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 155aa MW: 15925.8 Da PI: 9.9702 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 54.3 | 2.9e-17 | 11 | 41 | 26 | 56 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRla 56
+AtPk+i+elmkv+gLt+++vkSHLQkYRl+
Zpz_sc03262.1.g00070.1.sm.mk 11 VATPKQIRELMKVEGLTNDEVKSHLQKYRLH 41
7****************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| TIGRFAMs | TIGR01557 | 3.1E-14 | 10 | 41 | IPR006447 | Myb domain, plants |
| SuperFamily | SSF46689 | 3.17E-7 | 11 | 44 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 8.6E-15 | 11 | 44 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 155 aa Download sequence Send to blast |
MISCDATVRA VATPKQIREL MKVEGLTNDE VKSHLQKYRL HTRRPNSTVP TSSTSAATPA 60 PQVFVVGGIW VPPPEYAVAA AAAHPPVQQP TADASGGAST VYAPVATLPS GAQTQSRELG 120 AVKKQPNRFS DGRSAGDASS ASPAVSSSSS QTTSA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that may play a role in response to nitrogen. May be involved in a time-dependent signaling for transcriptional regulation of nitrate-responsive genes. Binds specifically to the DNA sequence motif 5'-GAATC-3' or 5'-GAATATTC-3'. Represses the activity of its own promoter trough binding to these motifs. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc03262.1.g00070.1.sm.mk |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by nitrate. {ECO:0000269|PubMed:23324170}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004954868.3 | 4e-38 | transcription factor NIGT1 | ||||
| Swissprot | Q6Z869 | 7e-31 | NIGT1_ORYSJ; Transcription factor NIGT1 | ||||
| TrEMBL | A0A1E5UQ02 | 4e-44 | A0A1E5UQ02_9POAL; Myb family transcription factor EFM | ||||
| STRING | Si019945m | 8e-39 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6470 | 37 | 54 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G68670.1 | 4e-21 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




