![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zpz_sc07121.1.g00010.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 87aa MW: 9810.91 Da PI: 10.5519 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25.1 | 4e-08 | 2 | 37 | 12 | 47 |
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
++ + +++G+g+W++I+r + Rt+ q+ s+ qky
Zpz_sc07121.1.g00010.1.sm.mk 2 FLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 37
777899***************99************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.11 | 1 | 42 | IPR017930 | Myb domain |
| CDD | cd00167 | 6.56E-6 | 1 | 38 | No hit | No description |
| SuperFamily | SSF46689 | 2.22E-10 | 1 | 43 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.3E-6 | 2 | 37 | IPR001005 | SANT/Myb domain |
| TIGRFAMs | TIGR01557 | 1.1E-11 | 2 | 40 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-6 | 2 | 37 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
LFLLGLEKYG KGDWRSISRN FVISRTPTQV ASHAQKYFIR LNSMNRERRR QSIHDITSVN 60 NGDASAAQGP ITGSANVTGW TEKSDDW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Zpz_sc07121.1.g00010.1.sm.mk |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HF679443 | 3e-71 | HF679443.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB37 protein. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025823483.1 | 4e-46 | transcription factor SRM1 | ||||
| Swissprot | Q9FNN6 | 1e-40 | SRM1_ARATH; Transcription factor SRM1 | ||||
| TrEMBL | A0A3L6PSD7 | 6e-45 | A0A3L6PSD7_PANMI; Uncharacterized protein | ||||
| TrEMBL | A0A3L6QCW8 | 7e-45 | A0A3L6QCW8_PANMI; Uncharacterized protein | ||||
| TrEMBL | I1PI25 | 1e-45 | I1PI25_ORYGL; Uncharacterized protein | ||||
| STRING | Pavir.Gb00055.1.p | 1e-45 | (Panicum virgatum) | ||||
| STRING | OPUNC04G27130.1 | 2e-45 | (Oryza punctata) | ||||
| STRING | ORGLA03G0402100.1 | 2e-46 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP9466 | 30 | 41 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G08520.1 | 6e-43 | MYB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




