![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 168aa MW: 19468.4 Da PI: 9.8097 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 162.5 | 1.5e-50 | 20 | 146 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekew 58
pGfrFhPtdeelv +yL++kv++k++ l + ik++diyk++PwdLp + + +ekew
augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1 20 LPGFRFHPTDEELVGFYLQRKVDKKPICL-DLIKHIDIYKHDPWDLP-TGSVGEKEW 74
69************************999.99***************.4456899** PP
NAM 59 yfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kgelvglkktLvfykgra 113
yfF++r kky+++ r+nr+t sg+Wkatg dk+++s +e +glkk+Lv+y+g+a
augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1 75 YFFCRRGKKYKNSVRPNRVTGSGFWKATGIDKAIYSVkePHECIGLKKSLVYYRGSA 131
***********************************97545566************** PP
NAM 114 pkgektdWvmheyrl 128
kg+ktdW+mhe+rl
augustus_masked-scaffold00498-abinit-gene-0.4-mRNA-1 132 GKGTKTDWMMHEFRL 146
*************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.96E-52 | 14 | 154 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 48.674 | 19 | 162 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.3E-26 | 21 | 146 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 168 aa Download sequence Send to blast |
MEVKKMSVLV NGCKDDEDFL PGFRFHPTDE ELVGFYLQRK VDKKPICLDL IKHIDIYKHD 60 PWDLPTGSVG EKEWYFFCRR GKKYKNSVRP NRVTGSGFWK ATGIDKAIYS VKEPHECIGL 120 KKSLVYYRGS AGKGTKTDWM MHEFRLPANK STNPSVTRNT TQEAVRFI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 1e-44 | 21 | 146 | 22 | 145 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023896588.1 | 1e-117 | transcription factor JUNGBRUNNEN 1-like | ||||
| Swissprot | Q9SK55 | 2e-71 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
| TrEMBL | A0A2N9EHV8 | 1e-101 | A0A2N9EHV8_FAGSY; Uncharacterized protein | ||||
| STRING | XP_010272267.1 | 4e-83 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1013 | 34 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G43000.1 | 9e-74 | NAC domain containing protein 42 | ||||




