![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | augustus_masked-scaffold03268-abinit-gene-0.3-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 91aa MW: 10481 Da PI: 10.2379 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 102.8 | 1.3e-32 | 24 | 74 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
augustus_masked-scaffold03268-abinit-gene-0.3-mRNA-1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 74
79***********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.501 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.8E-41 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 6.67E-31 | 17 | 80 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.38E-39 | 17 | 77 | No hit | No description |
| PRINTS | PR00404 | 8.4E-34 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.4E-34 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.4E-34 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0090376 | Biological Process | seed trichome differentiation | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MEFPNQALEG SSQRKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 IVFSSRGRLY EYSNNRFVTF FTFTSNQSSC S |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-20 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023917960.1 | 4e-48 | agamous-like MADS-box protein AGL1 | ||||
| Swissprot | Q01540 | 3e-39 | AG_BRANA; Floral homeotic protein AGAMOUS | ||||
| TrEMBL | A0A314U8G6 | 9e-47 | A0A314U8G6_PRUYE; Agamous-like MADS-box protein AGL1 | ||||
| STRING | XP_008229393.1 | 2e-44 | (Prunus mume) | ||||
| STRING | EMJ18463 | 2e-44 | (Prunus persica) | ||||
| STRING | XP_007146364.1 | 3e-46 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 5e-30 | MIKC_MADS family protein | ||||




