![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | augustus_masked-scaffold04687-abinit-gene-0.1-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 106aa MW: 12255.3 Da PI: 10.9035 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.7 | 4.8e-17 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd +l+++++++G g W++++ g++R++k+c++rw++yl
augustus_masked-scaffold04687-abinit-gene-0.1-mRNA-1 9 KGAWTGEEDIRLKQCIEKYGEGKWHLVPVSAGLNRCRKSCRLRWLNYL 56
79*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 22.976 | 4 | 60 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-21 | 6 | 58 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.3E-13 | 8 | 58 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.7E-15 | 9 | 56 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 7.43E-21 | 10 | 84 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.75E-10 | 11 | 56 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 7.2E-6 | 59 | 83 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MDGSFTVRKG AWTGEEDIRL KQCIEKYGEG KWHLVPVSAG LNRCRKSCRL RWLNYLKPNI 60 KRGKFAADEV DLMLRLHKLL GNRQVPRANN NNSKHRMSLV KTTAAY |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023919949.1 | 3e-63 | transcription factor MYB114-like | ||||
| Swissprot | Q9FNV9 | 2e-40 | MY113_ARATH; Transcription factor MYB113 | ||||
| TrEMBL | A0A2N9IFP5 | 2e-48 | A0A2N9IFP5_FAGSY; Uncharacterized protein | ||||
| STRING | VIT_14s0006g01280.t01 | 5e-44 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G66370.1 | 9e-43 | myb domain protein 113 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




