PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold05009-abinit-gene-0.0-mRNA-1
Organism
Castanea mollissima
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 109aa    MW: 12329.9 Da    PI: 7.0407
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold05009-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.12.8e-101341129
                                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHH CS
                                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIar 29
                                                          +g+W++eEde+l++++  +G g+W+++++
  augustus_masked-scaffold05009-abinit-gene-0.0-mRNA-1 13 KGPWSAEEDEKLINYISNYGHGCWSSVPK 41
                                                          79*************************98 PP
2Myb_DNA-binding38.13.6e-124481746
                                                          HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                                       Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                                          eE  l+ +++  lG++ W+ Ia+ ++ gRt++++k++w++
  augustus_masked-scaffold05009-abinit-gene-0.0-mRNA-1 44 EEAVLITELHGILGNK-WAQIAKQLP-GRTDNEVKNFWNT 81
                                                          89999***********.*********.***********96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-14642IPR009057Homeodomain-like
PROSITE profilePS5129417.367887IPR017930Myb domain
SuperFamilySSF466894.87E-191179IPR009057Homeodomain-like
SMARTSM007171.9E-141285IPR001005SANT/Myb domain
PfamPF002492.2E-81341IPR001005SANT/Myb domain
CDDcd001676.70E-111581No hitNo description
PfamPF002492.7E-104481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-174484IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MAHHSCCDKK VKKGPWSAEE DEKLINYISN YGHGCWSSVP KFAEEAVLIT ELHGILGNKW  60
AQIAKQLPGR TDNEVKNFWN TSIRKKLISY DVPAIATFPD VHFNGNSEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1248750108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023916583.14e-60transcription factor MYB24-like
SwissprotQ9SPG32e-39MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A2N9HIH56e-49A0A2N9HIH5_FAGSY; Uncharacterized protein
TrEMBLA0A2N9I8M22e-48A0A2N9I8M2_FAGSY; Uncharacterized protein
STRINGEOY271416e-48(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.23e-43myb domain protein 26
Publications ? help Back to Top
  1. Coego A, et al.
    The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression.
    Plant J., 2014. 77(6): p. 944-53
    [PMID:24456507]
  2. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  3. Ghelli R, et al.
    A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 620-637
    [PMID:29514943]