![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | augustus_masked-scaffold10132-abinit-gene-0.0-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 111aa MW: 11983.4 Da PI: 5.5299 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 48.9 | 1.8e-15 | 41 | 87 | 2 | 48 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT- CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhs 48
Fl+k+y++++d++++ ++sws ++nsfvv+++ efa+++LpkyFkh+
augustus_masked-scaffold10132-abinit-gene-0.0-mRNA-1 41 FLSKTYDMVDDPATDPILSWSPTNNSFVVWNPPEFARDLLPKYFKHR 87
9********************999**********************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.8E-18 | 32 | 87 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 4.08E-15 | 36 | 87 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.7E-12 | 37 | 108 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.2E-8 | 41 | 64 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.9E-12 | 41 | 87 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.2E-8 | 79 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MESVVTTESD SAVSSGSVGG GAQQQQQGPS PMQSGNGPPP FLSKTYDMVD DPATDPILSW 60 SPTNNSFVVW NPPEFARDLL PKYFKHRIGC VAMHVVTPHL VAENPFRKIG N |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 6e-13 | 39 | 86 | 27 | 74 | Heat shock factor protein 1 |
| 5d5v_B | 6e-13 | 39 | 86 | 27 | 74 | Heat shock factor protein 1 |
| 5d5v_D | 6e-13 | 39 | 86 | 27 | 74 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023923292.1 | 3e-32 | heat shock factor protein HSF8 | ||||
| Swissprot | P41151 | 7e-26 | HFA1A_ARATH; Heat stress transcription factor A-1a | ||||
| TrEMBL | A0A2N9G103 | 1e-32 | A0A2N9G103_FAGSY; Uncharacterized protein | ||||
| STRING | Gorai.008G225200.1 | 4e-31 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17750.1 | 4e-25 | heat shock factor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




